DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha14-1 and Atp6v1f

DIOPT Version :9

Sequence 1:NP_476969.1 Gene:Vha14-1 / 36731 FlyBaseID:FBgn0262512 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_079657.1 Gene:Atp6v1f / 66144 MGIID:1913394 Length:119 Species:Mus musculus


Alignment Length:115 Identity:82/115 - (71%)
Similarity:101/115 - (87%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRFLKRDDIDIILINQ 72
            :||||:|||||||..||||||:||:||||||||:||:|:|.::|:||.|::||.||||.||||||
Mouse     4 RGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQ 68

  Fly    73 NCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMFNPEDL 122
            ..||::||.:|||...:|||||||||:|||||:||||||||:|||..|||
Mouse    69 YIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha14-1NP_476969.1 V_ATP_synt_F 5..119 CDD:130171 79/110 (72%)
Atp6v1fNP_079657.1 V_ATP_synt_F 1..115 CDD:130171 79/110 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 160 1.000 Domainoid score I4052
eggNOG 1 0.900 - - E1_COG1436
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3119
Inparanoid 1 1.050 181 1.000 Inparanoid score I3975
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54139
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005005
OrthoInspector 1 1.000 - - oto93924
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - LDO PTHR13861
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1633
SonicParanoid 1 1.000 - - X3539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.