DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha14-1 and Vha14-2

DIOPT Version :9

Sequence 1:NP_476969.1 Gene:Vha14-1 / 36731 FlyBaseID:FBgn0262512 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_649614.1 Gene:Vha14-2 / 40748 FlyBaseID:FBgn0037402 Length:129 Species:Drosophila melanogaster


Alignment Length:76 Identity:43/76 - (56%)
Similarity:58/76 - (76%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NTAVSELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSIL 110
            :|...::|:|||:||:|.||.||||||..|::||..:|||...||.|||||||.||||:|:||||
  Fly    51 DTTPKQIEECFKKFLRRPDIVIILINQVYADMIRPTVDAHNLAVPTVLEIPSKQHPYDSSRDSIL 115

  Fly   111 RRARGMFNPED 121
            :||:.:..|.:
  Fly   116 KRAQRVITPPE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha14-1NP_476969.1 V_ATP_synt_F 5..119 CDD:130171 42/72 (58%)
Vha14-2NP_649614.1 ATP-synt_F <51..124 CDD:294422 42/72 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1436
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13861
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.