DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha14-1 and CG15719

DIOPT Version :10

Sequence 1:NP_476969.1 Gene:Vha14-1 / 36731 FlyBaseID:FBgn0262512 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_572846.2 Gene:CG15719 / 32249 FlyBaseID:FBgn0030440 Length:160 Species:Drosophila melanogaster


Alignment Length:87 Identity:24/87 - (27%)
Similarity:51/87 - (58%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRFLKRDDIDIILINQNCAE 76
            :::|...:..:||||.||| ..|:|..|:|:|:..|...::|..|....:|.:|.|::|:.:..:
  Fly    53 VAIIACPEVTLGFLLCGVG-YQKDRFRNYMMVESETPQEDVEQFFLTVYRRSNIGIVIIDYDTVK 116

  Fly    77 LIRHVIDAHTSPVPAVLEIPSK 98
            .:|.::...:..:|.::.:|:|
  Fly   117 RLRTMMQRCSQLLPVLVTVPNK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha14-1NP_476969.1 V_ATP_synt_F 5..119 CDD:130171 24/87 (28%)
CG15719NP_572846.2 ATP-synt_F 53..140 CDD:460409 24/87 (28%)

Return to query results.
Submit another query.