DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha14-1 and vma7

DIOPT Version :9

Sequence 1:NP_476969.1 Gene:Vha14-1 / 36731 FlyBaseID:FBgn0262512 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_596676.1 Gene:vma7 / 2540982 PomBaseID:SPBC3B9.18c Length:120 Species:Schizosaccharomyces pombe


Alignment Length:115 Identity:57/115 - (49%)
Similarity:73/115 - (63%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRF-LKRDD 64
            |:..|..:..|:|||||:||..|.||.|.|::|:|...||.::.:.|...::.:.|..: .||.|
pombe     1 MSSQSYRERTLVSVIGDDDTVTGMLLAGTGQVNENGDKNFFIITQKTTDEQIAEAFDDYTTKRKD 65

  Fly    65 IDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRAR 114
            |.|:||||..||.||..|:.|....||||||||||.|||..|||||||.|
pombe    66 IAIVLINQFAAERIRDRIENHVQAFPAVLEIPSKDDPYDPEKDSILRRVR 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha14-1NP_476969.1 V_ATP_synt_F 5..119 CDD:130171 56/111 (50%)
vma7NP_596676.1 ATP-synt_F 8..120 CDD:294422 55/108 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I1713
eggNOG 1 0.900 - - E1_COG1436
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3119
Inparanoid 1 1.050 109 1.000 Inparanoid score I1589
OMA 1 1.010 - - QHG54139
OrthoFinder 1 1.000 - - FOG0005005
OrthoInspector 1 1.000 - - oto101441
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - LDO PTHR13861
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1633
SonicParanoid 1 1.000 - - X3539
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.