DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8207 and APS2

DIOPT Version :9

Sequence 1:NP_611051.2 Gene:CG8207 / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001322344.1 Gene:APS2 / 837066 AraportID:AT1G05610 Length:482 Species:Arabidopsis thaliana


Alignment Length:433 Identity:83/433 - (19%)
Similarity:145/433 - (33%) Gaps:122/433 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVILIGGPQKGTRFRPLSLDTPKPLFPLAGR-PLIAHHIEACAQLPDIREILIIGYYPQTQMEGF 67
            |.|:.||......: ||:....|...|:|.. .||...|..|.. ..|.:|..|..:..|.:.  
plant    56 AAIVFGGGSDSELY-PLTKTRSKGAIPIAANYRLIDAVISNCIN-SGITKIYAITQFNSTSLN-- 116

  Fly    68 VGDMQALYSSSNIN----IRYLQEFTALGTAGGMYHFRDQIRAGNPRAFFVLNGDVCADFPLQEL 128
             ..:...||...:.    :..:..:.:|...|......|.||    |..:|..     :||:.|.
plant   117 -SHLSKAYSGFGLGKDRFVEVIAAYQSLEDQGWFQGTADAIR----RCLWVFE-----EFPVTEF 171

  Fly   129 ----------CDF----HEKRPASALVTIMSTEATRQQSLHYGCLVFDRSSGAVSHYVEKPSSYV 179
                      .|:    .:.|.:.|.:||:...:.......:|.:..| |:.||:.:..|....:
plant   172 LVLPGHHLYKMDYKMLIEDHRRSRADITIVGLSSVTDHDFGFGFMEVD-STNAVTRFTIKGQQDL 235

  Fly   180 STFIN------CGVYVCSM---DIFTVLAQIFHSRGQEYSCQAFCNGNGNGNGREQGHIKWEQEV 235
            .:..|      .|...||:   .|:.:                         |||| .:|..:|.
plant   236 ISVANRTATRSDGTSSCSVPSAGIYVI-------------------------GREQ-MVKLLREC 274

  Fly   236 L----------TPLAGTD--KLFAMPVPNWWSQLKTAGSAIYAN-------------RHY----- 270
            |          .|.|.::  |:.|.....:|..:::.|:...||             |.|     
plant   275 LIKSKDLASEIIPGAISEGMKVKAHMFDGYWEDVRSIGAYYRANMESIKRCRLDLNYRFYDRQCP 339

  Fly   271 LGLYKKTHPERLANVGIKRGE--GDGSLI--CTVHPDVY-----VHPSATVHHSAVLGPNV---- 322
            |....:..|....:|.:....  |||.::  |.:...|.     :.....|..|.::|.::    
plant   340 LYTMPRCLPPSSMSVAVITNSIIGDGCILDKCVIRGSVVGMRTRIADEVIVEDSIIVGSDIYEME 404

  Fly   323 ----------AIGPGVTIGPGVRIRESIVLEQAQILDHTLVLH 355
                      .|...:.||...|||.:||.:.|:|..:.::::
plant   405 EDVRRKGKEKKIEIRIGIGEKSRIRRAIVDKNARIGKNVMIIN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8207NP_611051.2 GCD1 1..366 CDD:224129 83/433 (19%)
M1P_guanylylT_A_like_N 4..270 CDD:133050 61/318 (19%)
LbetaH 306..372 CDD:294107 13/64 (20%)
APS2NP_001322344.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D806744at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.