DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8207 and zgc:136439

DIOPT Version :9

Sequence 1:NP_611051.2 Gene:CG8207 / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001035462.1 Gene:zgc:136439 / 678627 ZFINID:ZDB-GENE-060421-2858 Length:274 Species:Danio rerio


Alignment Length:209 Identity:50/209 - (23%)
Similarity:75/209 - (35%) Gaps:62/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKAVILIGGPQKGTRF-RPLSLDT----------PKPLFPLAGRPLIAHHIEACAQLPDIREILI 55
            :|||||..|  .|||. |.:.:||          .|||.|:....||:|.::|..:...:..:.:
Zfish     1 MKAVILAAG--YGTRLQRDIEIDTTGKFKHLKGIAKPLLPVGSCALISHWLQALTKTGCVDTVYV 63

  Fly    56 IGYYPQTQMEGFVGDMQALYSSSNINIRYLQEFTAL-----GTAGGMYHFRDQIRAGNPRA---- 111
            :  ......|.|.              ::.|||..:     ||.      |::.|.|....    
Zfish    64 V--TNDLHHEAFQ--------------QWAQEFPNVKIINDGTR------RNKDRHGAVACLQLT 106

  Fly   112 ---------FFVLNGDVC--ADFPLQELCD-FHE---KRPASALVTIMSTEATRQQSLHYGCLVF 161
                     ..|:.||..  .||.|:...: |.|   |...|.||  ::.....:::..||.|..
Zfish   107 IKLCAVDDDLLVIGGDTLFKEDFSLRTFTERFFEVQSKDKESNLV--LAYRCKDEETSKYGILEL 169

  Fly   162 DRSSGAVSHYVEKP 175
            |... .|....|||
Zfish   170 DEDL-KVQCLKEKP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8207NP_611051.2 GCD1 1..366 CDD:224129 50/209 (24%)
M1P_guanylylT_A_like_N 4..270 CDD:133050 49/207 (24%)
LbetaH 306..372 CDD:294107
zgc:136439NP_001035462.1 GCD1 1..>269 CDD:224129 50/209 (24%)
Glyco_tranf_GTA_type 3..250 CDD:299700 49/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.