DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8207 and gmppb

DIOPT Version :9

Sequence 1:NP_611051.2 Gene:CG8207 / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_012820013.1 Gene:gmppb / 493267 XenbaseID:XB-GENE-922650 Length:367 Species:Xenopus tropicalis


Alignment Length:430 Identity:125/430 - (29%)
Similarity:194/430 - (45%) Gaps:78/430 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKAVILIGGPQKGTRFRPLSLDTPKPLFPLAGRPLIAHHIEACAQLPDIREILIIGYYPQTQMEG 66
            :||:||:||  .|||.|||:|..||||.....:|::.|.:||..: ..:..:::...|....:| 
 Frog     8 MKALILVGG--YGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVK-AGVNHVILAVSYMSDMLE- 68

  Fly    67 FVGDMQALYSSSNINIRYLQEFTALGTAGGMYHFRDQIRAGNPRAFFVLNGDVCADFPLQELCDF 131
              .:|:.......|.|....|...|||||.:...| ::...|...|||||.||..|||.:|:..|
 Frog    69 --KEMKEQEKRLGIRISMSHEKEPLGTAGPLALAR-ELLTENSDPFFVLNSDVICDFPFEEMVRF 130

  Fly   132 HEKRPASALVTIMSTEATRQQSLHYGCLVFDRSSGAVSHYVEKPSSYVSTFINCGVYVCSMDIFT 196
            |:.......:.:...|    :...||.:|::..||.:..:||||..:||..||.|:|:.|.   .
 Frog   131 HKHHGKEGTIVVTKVE----EPSKYGVVVYEAESGQIQRFVEKPQVFVSNKINSGLYIFSP---A 188

  Fly   197 VLAQIFHSRGQEYSCQAFCNGNGNGNGREQGHIKWEQEVLTPLAGTDKLFAMPVPNWWSQLKTAG 261
            ||.:|                       :......|:|:...:|...:||||.:..:|..:....
 Frog   189 VLDRI-----------------------QLRPTSIEKEIFPAMAQEGQLFAMELQGFWMDIGQPK 230

  Fly   262 SAIYANRHYLGLYKKTHPERLANVGIKRGEGDGSLICTVHPDVYVHPSATVHHSAVLGPNVAIGP 326
            ..:.....||...::.|||.|       ..|.|.:     .:|.|.|:|.:..:..:||||.|||
 Frog   231 DFLTGMCMYLQSVRQKHPEWL-------HVGPGFI-----GNVLVDPTAKIGQNCSIGPNVTIGP 283

  Fly   327 GVTIGPGVRIRESIVLEQAQILDHTLVLHSIVGRGSTIGAWARVEGTPSDPDPNKPFAKMENPPL 391
            |||:..||||:...:::.:::..|:.:..||||..|::|.|.|:|                    
 Frog   284 GVTVEDGVRIKRCTIMKGSRLHSHSWLESSIVGWSSSVGQWVRME-------------------- 328

  Fly   392 FNNEGKLNPSITILGCFVQVPAEKILLNSIVLPHKELSRS 431
                     ::|:||..|.|..|..|..:.|||||.:|.|
 Frog   329 ---------NVTVLGEDVIVNDELYLNGANVLPHKCISES 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8207NP_611051.2 GCD1 1..366 CDD:224129 107/363 (29%)
M1P_guanylylT_A_like_N 4..270 CDD:133050 74/265 (28%)
LbetaH 306..372 CDD:294107 26/65 (40%)
gmppbXP_012820013.1 M1P_guanylylT_B_like_N 8..240 CDD:133047 75/268 (28%)
LbetaH 262..341 CDD:381831 32/107 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D336231at33208
OrthoFinder 1 1.000 - - FOG0000664
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.