DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8207 and eIF2Bgamma

DIOPT Version :9

Sequence 1:NP_611051.2 Gene:CG8207 / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_611046.2 Gene:eIF2Bgamma / 36722 FlyBaseID:FBgn0034029 Length:455 Species:Drosophila melanogaster


Alignment Length:498 Identity:94/498 - (18%)
Similarity:174/498 - (34%) Gaps:148/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAVILIGGPQKGTRFRPLSLDTPKPLFPLAGRPLIAHHIEACAQLPDIREILIIGYYPQTQMEGF 67
            :||:...|  :|||...:..|.||.|.|:...|||.:.:....| .:..|:::: ...|.::|  
  Fly     5 QAVVFAAG--RGTRLPEVLGDAPKCLLPVGPYPLIWYPLNLLQQ-HNFTEVIVV-VLEQEKLE-- 63

  Fly    68 VGDMQALYSSSNINIRYLQEFTAL------GTAGGMYHFRDQIRAGNPRAFFVLNGDVCADFPLQ 126
               :|:...::.:.:|.  ::..:      |||..:.:..|:|::.    |.|::.|:.::..|.
  Fly    64 ---IQSALENTPLKLRL--DYATIPSDGDFGTADSLRYIYDKIKSD----FLVVSCDLVSNVSLY 119

  Fly   127 ELCD-FHEKRPASALVTIMSTEATRQQSLHYGCLVFDRSSGAVSHYV-------EKPS------- 176
            .|.: |.|...|.|:                  |:|  .||..|..|       .||.       
  Fly   120 PLINKFREHDAALAM------------------LLF--PSGFESDVVMPGPKSKHKPERDLIGIH 164

  Fly   177 ------SYVSTFINCGVYVCSMDIFTVLAQIFHSRGQ--EYSCQAFCNGNGNGNGREQGHI---- 229
                  ::||...:|      .:...:...:..:||:  .||...            ..|:    
  Fly   165 AATQRLAFVSAASDC------EETLNIQRHLLKNRGRLDVYSRLV------------DAHVYVLK 211

  Fly   230 KW------EQEVLTPLAG------TDKLFAMPVPNWWSQLKTAGSAIYANR----HYLG---LYK 275
            ||      .:|.::...|      ..|..:...|.......:....:..|.    ||:|   |.:
  Fly   212 KWVIDYLRRKENISTFKGEFLPHLIKKQHSKRPPKTVQDTTSEVGVVTKNEDHVLHYVGHTILDQ 276

  Fly   276 KTHPERLANVGIKRGEGDGSLI-C----TVHPDVYVHPSATVHHSAV------LGPNVA------ 323
            |.....|.|..:.:....|.:: |    .....:.|..:.|:...|:      :..|:.      
  Fly   277 KITQTSLFNQSLSQSPYHGDIVRCYGIQAPRDAIGVRVNNTLSFLAINRKLASIWNNLCGEKHPL 341

  Fly   324 IGPGVTIGPGVRIRESIVLEQAQILDHTLVLHSIVGRGSTIGAWARVEGTPSDPDPN---KPFAK 385
            |.||..: ...:.:|.|..:.|::.:.|.:..|:.|                   ||   .|...
  Fly   342 ISPGAVV-KSTQTKEIIAADNAKLSEKTSLNFSVFG-------------------PNCIISPKNI 386

  Fly   386 MENPPLFNN---EGKLNPSITILGCFVQVPAEKILLNSIVLPH 425
            :.|..:.:|   |...|....|:|...||.:..:|.|.|:.|:
  Fly   387 VANSLIMSNAIVEEGCNIDNCIIGHRAQVKSGSVLKNCIIGPN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8207NP_611051.2 GCD1 1..366 CDD:224129 79/431 (18%)
M1P_guanylylT_A_like_N 4..270 CDD:133050 57/314 (18%)
LbetaH 306..372 CDD:294107 13/77 (17%)
eIF2BgammaNP_611046.2 eIF-2B_gamma_N 4..215 CDD:133041 52/262 (20%)
GCD1 5..441 CDD:224129 94/498 (19%)
LbH_eIF2B_gamma_C 357..437 CDD:100057 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456489
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.