DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8207 and GMPPB

DIOPT Version :9

Sequence 1:NP_611051.2 Gene:CG8207 / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_037466.3 Gene:GMPPB / 29925 HGNCID:22932 Length:387 Species:Homo sapiens


Alignment Length:444 Identity:140/444 - (31%)
Similarity:200/444 - (45%) Gaps:79/444 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKAVILIGGPQKGTRFRPLSLDTPKPLFPLAGRPLIAHHIEACAQLPDIREILIIGYYPQTQMEG 66
            :||:||:||  .|||.|||:|.|||||.....:|::.|.:||.|.......||.:.|..|...: 
Human     1 MKALILVGG--YGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEK- 62

  Fly    67 FVGDMQALYSSSNINIRYLQEFTALGTAGGMYHFRDQI-RAGNPRAFFVLNGDVCADFPLQELCD 130
               :|:|......|.|....|...|||||.:...||.: ...:|  |||||.||..|||.|.:..
Human    63 ---EMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADP--FFVLNSDVICDFPFQAMVQ 122

  Fly   131 FHEK--RPASALVTIMSTEATRQQSLHYGCLVFDRSSGAVSHYVEKPSSYVSTFINCGVYVCSMD 193
            ||..  :..|.|||.:      ::...||.:|.:..:|.:..:||||..:||..||.|:|:.|. 
Human   123 FHRHHGQEGSILVTKV------EEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSP- 180

  Fly   194 IFTVLAQIFHSRGQEYSCQAFCNGNGNGNGREQGHIKWEQEVLTPLAGTDKLFAMPVPNWWSQLK 258
              .||.:|   :.|..|.                    |:||...:|...:|:||.:..:|..:.
Human   181 --AVLQRI---QLQPTSI--------------------EKEVFPIMAKEGQLYAMELQGFWMDIG 220

  Fly   259 TAGSAIYANRHYLGLYKKTHPERLANVGIKRGEGDGSLICTVHPDVYVHPSATVHHSAVLGPNVA 323
            .....:.....:|...::..||||.:       |.|     :..:|.|.|||.:..:..:||||:
Human   221 QPKDFLTGMCLFLQSLRQKQPERLCS-------GPG-----IVGNVLVDPSARIGQNCSIGPNVS 273

  Fly   324 IGPGVTIGPGVRIRESIVLEQAQILDHTLVLHSIVG----RGSTIGAWARVEGTPSD-----PDP 379
            :||||.:..||.||...||..|:|..|:.:...|||    .|..:..||.:.|....     ||.
Human   274 LGPGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVSLWAGLGGERGGECACLPDK 338

  Fly   380 NKPF--AKMENPPLFNNEGKLNPSITILGCFVQVPAEKILLNSIVLPHKELSRS 431
            ..|.  .:|||             :|:||..|.|..|..|..:.|||||.:..|
Human   339 AYPLLEVRMEN-------------VTVLGEDVIVNDELYLNGASVLPHKSIGES 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8207NP_611051.2 GCD1 1..366 CDD:224129 118/370 (32%)
M1P_guanylylT_A_like_N 4..270 CDD:133050 84/268 (31%)
LbetaH 306..372 CDD:294107 27/69 (39%)
GMPPBNP_037466.3 M1P_guanylylT_B_like_N 1..233 CDD:133047 85/271 (31%)
LbetaH 255..361 CDD:412191 39/118 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1057
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D336231at33208
OrthoFinder 1 1.000 - - FOG0000664
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.