DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8207 and eif-2Bepsilon

DIOPT Version :9

Sequence 1:NP_611051.2 Gene:CG8207 / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_495841.1 Gene:eif-2Bepsilon / 174387 WormBaseID:WBGene00008428 Length:666 Species:Caenorhabditis elegans


Alignment Length:115 Identity:28/115 - (24%)
Similarity:45/115 - (39%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 VAIGPGVTIGPGVRIRESIVLEQAQILDHTLVLHSIVGRGSTIGAWARVEGTPSDPDPNKPFAKM 386
            |.:|....|.....||.|.:....:|...|.:..|::|:...||....:|           :|.:
 Worm   329 VCLGVKTDIAYDAFIRNSCIGAHTEISSKTRITSSMIGKNCKIGENCVIE-----------YAFI 382

  Fly   387 ENPPLFNNEGKLNPSITILGCFVQVPAEKILLNSIVLPHKELSRSFKNEI 436
            .:..:..| |...|..:|:|..|..|.|        ||:.:.:..|||.|
 Worm   383 GDDVVIPN-GAHIPKESIIGNGVMYPKE--------LPNIQNTAIFKNAI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8207NP_611051.2 GCD1 1..366 CDD:224129 11/43 (26%)
M1P_guanylylT_A_like_N 4..270 CDD:133050
LbetaH 306..372 CDD:294107 12/49 (24%)
eif-2BepsilonNP_495841.1 Glyco_tranf_GTA_type 19..218 CDD:386096
LbetaH 331..404 CDD:381831 18/84 (21%)
W2_eIF2B_epsilon 484..655 CDD:211396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.