DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmppa and eif-2Bepsilon

DIOPT Version :10

Sequence 1:NP_611051.2 Gene:Gmppa / 36730 FlyBaseID:FBgn0034035 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_495841.1 Gene:eif-2Bepsilon / 174387 WormBaseID:WBGene00008428 Length:666 Species:Caenorhabditis elegans


Alignment Length:115 Identity:28/115 - (24%)
Similarity:45/115 - (39%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 VAIGPGVTIGPGVRIRESIVLEQAQILDHTLVLHSIVGRGSTIGAWARVEGTPSDPDPNKPFAKM 386
            |.:|....|.....||.|.:....:|...|.:..|::|:...||....:|           :|.:
 Worm   329 VCLGVKTDIAYDAFIRNSCIGAHTEISSKTRITSSMIGKNCKIGENCVIE-----------YAFI 382

  Fly   387 ENPPLFNNEGKLNPSITILGCFVQVPAEKILLNSIVLPHKELSRSFKNEI 436
            .:..:..| |...|..:|:|..|..|.|        ||:.:.:..|||.|
 Worm   383 GDDVVIPN-GAHIPKESIIGNGVMYPKE--------LPNIQNTAIFKNAI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmppaNP_611051.2 M1P_guanylylT_A_like_N 4..270 CDD:133050
LbetaH 306..372 CDD:469633 12/49 (24%)
eif-2BepsilonNP_495841.1 Glyco_tranf_GTA_type 19..218 CDD:472172
LbetaH 331..404 CDD:469633 18/84 (21%)
W2_eIF2B_epsilon 484..655 CDD:211396
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.