DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and ZNHIT3

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_004764.1 Gene:ZNHIT3 / 9326 HGNCID:12309 Length:155 Species:Homo sapiens


Alignment Length:146 Identity:56/146 - (38%)
Similarity:75/146 - (51%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPTDDTV 68
            |:||::. .||:|..|..|||||.|::.|::.....||..: ||.......:....|....||..
Human    11 CVICLEK-PKYRCPACRVPYCSVVCFRKHKEQCNPETRPVE-KKIRSALPTKTVKPVENKDDDDS 73

  Fly    69 AAE-----------KLQQLENCQE---LRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVE 119
            .|:           .||.|:|..|   ||:||.|||||.|:..:|...:....|.|.||||||||
Human    74 IADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVE 138

  Fly   120 FANACLQVVEPMTDAE 135
            ||:.||.:|||..:.|
Human   139 FADCCLGIVEPSQNEE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 13/25 (52%)
ZNHIT3NP_004764.1 zf-HIT 7..36 CDD:309543 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159366
Domainoid 1 1.000 66 1.000 Domainoid score I9982
eggNOG 1 0.900 - - E1_KOG2857
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37964
Inparanoid 1 1.050 92 1.000 Inparanoid score I5093
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57310
OrthoDB 1 1.010 - - D1551354at2759
OrthoFinder 1 1.000 - - FOG0005675
OrthoInspector 1 1.000 - - oto90918
orthoMCL 1 0.900 - - OOG6_104054
Panther 1 1.100 - - LDO PTHR13483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 1 1.000 - - X4652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.