DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and HIT1

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_012589.1 Gene:HIT1 / 853516 SGDID:S000003816 Length:164 Species:Saccharomyces cerevisiae


Alignment Length:134 Identity:40/134 - (29%)
Similarity:62/134 - (46%) Gaps:19/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCIIC--VDNLRKYKCSKCSAPYCSVACYK-----THRDSPQCATRESDLKKTEVGYQEEPTLHV 60
            ||.||  ||.  ||||.||...|||:.|||     .|::|.|  .|.......|| ...:..::.
Yeast     7 KCGICRGVDG--KYKCPKCGVRYCSLKCYKDAAKHVHKESEQ--PRAGTEANVEV-VNNDKIINS 66

  Fly    61 PFPTDDTVAAEKLQQL-ENCQELRNLL-HNP---HLRSLLQQIDVAINAQSA--MMAAMQEPLFV 118
            ....:.|:..:....: :|..||:.|| :|.   ||..:.:.:...:|..|:  |.:.:|:.|.|
Yeast    67 SLAMNKTLKTKAFDDIYQNSAELQELLKYNTVKFHLAKVYRILSSTVNDGSSGKMNSDLQKELAV 131

  Fly   119 EFAN 122
            .:.|
Yeast   132 NYLN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 16/28 (57%)
HIT1NP_012589.1 zf-HIT 4..34 CDD:398237 16/28 (57%)
Hit1_C 79..159 CDD:408083 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I1881
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005675
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104054
Panther 1 1.100 - - LDO PTHR13483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.