DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and znhit3

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001039046.1 Gene:znhit3 / 733819 XenbaseID:XB-GENE-5750415 Length:145 Species:Xenopus tropicalis


Alignment Length:136 Identity:49/136 - (36%)
Similarity:73/136 - (53%) Gaps:8/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRE------SDLKKTEVGYQEEPTLH 59
            ::.|.:|.....||:|..|.|.||||:|.|.|::  :|..:.      :.:.:.|.....|..|.
 Frog     3 LKPCCVCYSVTPKYRCPGCRARYCSVSCCKRHKE--ECTLKSTPADTITQIDRGEKLLPREDDLI 65

  Fly    60 VPFPTDDTVAAEKLQQLENCQELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVEFANAC 124
            ......|.|...||:.|...::|::||.|||||.||.::|.|...:..:...||||||||||:.|
 Frog    66 DEDNESDRVPQHKLKLLGESEKLKHLLLNPHLRELLIKLDQAEEREDTVKKYMQEPLFVEFADRC 130

  Fly   125 LQVVEP 130
            |.::||
 Frog   131 LSIIEP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 12/28 (43%)
znhit3NP_001039046.1 zf-HIT 2..32 CDD:367943 12/28 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37964
Inparanoid 1 1.050 91 1.000 Inparanoid score I4955
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551354at2759
OrthoFinder 1 1.000 - - FOG0005675
OrthoInspector 1 1.000 - - oto104703
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 1 1.000 - - X4652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.