DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and znhit3

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_956567.1 Gene:znhit3 / 393243 ZFINID:ZDB-GENE-040426-1114 Length:151 Species:Danio rerio


Alignment Length:151 Identity:63/151 - (41%)
Similarity:87/151 - (57%) Gaps:9/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQC-ATRESD---LKKTEVGYQEEP-TLHV 60
            |:.|.:|.:.:.||:|..|...||||:|:|.|::...| ..:|||   .|...|...||| |:..
Zfish     1 MQLCGVCSELVPKYRCPACRIRYCSVSCFKRHKEDDSCDPVKESDPASSKPAAVSNAEEPWTVED 65

  Fly    61 PFPTD---DTVAAEKLQQLENCQELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVEFAN 122
            ....|   |.|..::||||.:.:.|:.||.|||||.|:..:|.|.|...||..|||||||||||:
Zfish    66 LLDEDSQTDKVPLQRLQQLGDSEALKGLLRNPHLRQLMMSVDSAENKAKAMKDAMQEPLFVEFAD 130

  Fly   123 ACLQVVEPM-TDAERTEFELY 142
            .||:::||. ||....:.:.|
Zfish   131 QCLKIIEPSETDNNEDDDDEY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 12/28 (43%)
znhit3NP_956567.1 zf-HIT 1..30 CDD:282314 12/28 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595518
Domainoid 1 1.000 78 1.000 Domainoid score I8726
eggNOG 1 0.900 - - E1_KOG2857
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37964
Inparanoid 1 1.050 111 1.000 Inparanoid score I4858
OMA 1 1.010 - - QHG57310
OrthoDB 1 1.010 - - D1551354at2759
OrthoFinder 1 1.000 - - FOG0005675
OrthoInspector 1 1.000 - - oto41681
orthoMCL 1 0.900 - - OOG6_104054
Panther 1 1.100 - - LDO PTHR13483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 1 1.000 - - X4652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.