DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and Znhit2

DIOPT Version :10

Sequence 1:NP_611050.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_038887.2 Gene:Znhit2 / 29805 MGIID:1352481 Length:399 Species:Mus musculus


Alignment Length:133 Identity:31/133 - (23%)
Similarity:47/133 - (35%) Gaps:45/133 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPTDDTVAAEKLQQLE 77
            :|.|.:|:|||||:.||:.|   ..||   .|..:.:|                           
Mouse    19 RYTCPRCNAPYCSLRCYRAH---GACA---EDFYRDQV--------------------------- 50

  Fly    78 NCQELRNLLHNPH-----LRSLLQQIDVAINAQSAMMAAMQEPLFVEFANACLQVVEPMTDAERT 137
             .:|||....:|.     ||.|.:|.:.....:.|.:.....|      .....:.|.:|.||:.
Mouse    51 -LRELRGRSASPSRLAGALRRLREQREAEDEPEEAGLGPGARP------GGLSGLWERLTPAEKA 108

  Fly   138 EFE 140
            .||
Mouse   109 AFE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_611050.1 zf-HIT_ZNHIT2-3 3..35 CDD:467796 11/21 (52%)
Znhit2NP_038887.2 zf-HIT_ZNHIT2-3 6..43 CDD:467796 13/29 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..97 4/32 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..175
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.