powered by:
Protein Alignment CG8204 and SPCC613.07
DIOPT Version :9
Sequence 1: | NP_001286464.1 |
Gene: | CG8204 / 36728 |
FlyBaseID: | FBgn0034033 |
Length: | 143 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_587695.1 |
Gene: | SPCC613.07 / 2539305 |
PomBaseID: | SPCC613.07 |
Length: | 345 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 58 |
Identity: | 14/58 - (24%) |
Similarity: | 24/58 - (41%) |
Gaps: | 12/58 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVP 61
|..|..|..||:|.:|.:.:|.:.|...|:...:|:. :.:|...||
pombe 9 CSTCQKNASKYRCPRCDSRFCCLECNLEHKRLTKCSG------------ERDPATFVP 54
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R130 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.