powered by:
Protein Alignment CG8204 and Znhit6
DIOPT Version :9
Sequence 1: | NP_001286464.1 |
Gene: | CG8204 / 36728 |
FlyBaseID: | FBgn0034033 |
Length: | 143 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001074563.1 |
Gene: | Znhit6 / 229937 |
MGIID: | 1916996 |
Length: | 460 |
Species: | Mus musculus |
Alignment Length: | 39 |
Identity: | 12/39 - (30%) |
Similarity: | 19/39 - (48%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCA 39
:.:|..|.....||:|.:|....||:.|.|.|:....|:
Mouse 208 LSRCETCGTEEAKYRCPRCMRFSCSLPCVKKHKADLTCS 246
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R130 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.