DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and zhit-3

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_505627.1 Gene:zhit-3 / 179420 WormBaseID:WBGene00006489 Length:455 Species:Caenorhabditis elegans


Alignment Length:120 Identity:30/120 - (25%)
Similarity:43/120 - (35%) Gaps:29/120 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQC-ATRES----------------------DL 45
            |.:|:.|..||||.:|....||:.|.|.|:....| ..|::                      .|
 Worm    84 CKVCLKNEHKYKCPRCEMRTCSLDCSKKHKADNNCDGVRQAFTKVDKLSQYDPQKSIDDQKFMHL 148

  Fly    46 KKTEVGYQEEPTLHVPFPTDDTVAAEK------LQQLENCQELRNLLHNPHLRSL 94
            .|.:||...||...|....:.:...||      |:...|....|.||:....|.:
 Worm   149 MKEKVGLGAEPVGGVGNDVNSSDGEEKPVDPNALRYTTNSPTERYLLNAARFRHI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 11/25 (44%)
zhit-3NP_505627.1 zf-HIT 81..110 CDD:367943 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.