DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and CDC28

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_009718.3 Gene:CDC28 / 852457 SGDID:S000000364 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:163/300 - (54%)
Similarity:211/300 - (70%) Gaps:17/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKYDKMEKIGEGTYGTVFKG---RNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKN 62
            :..|.::||:||||||.|:|.   |......:||||::||:.:||||||:|:|||.||||||..|
Yeast     5 LANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDN 69

  Fly    63 IVRLIDVLHSD-KKLTLVFEHCDQDLKKYFDSL--NGEIDMAVCRSFMLQLLRGLAFCHSHNVLH 124
            ||||.|::||| .||.||||..|.|||:|.:.:  :..:...:.:.||:||.:|:|:||||.:||
Yeast    70 IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILH 134

  Fly   125 RDLKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAG 189
            ||||||||||||:|.|||.|||||||||:|::.|:.|:||||||.|:||.|.|.|:|.:|.||.|
Yeast   135 RDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIG 199

  Fly   190 CILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSW-----S 249
            ||.||:.:. :|:|.|...:||:.|||||||||||..||.:.:|.|:  .||||   .|     |
Yeast   200 CIFAEMCNR-KPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDF--KPSFP---QWRRKDLS 258

  Fly   250 QLVPRLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTDS 289
            |:||.|:.:|.|||.|||...|..||||..|..||||.:|
Yeast   259 QVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 162/297 (55%)
STKc_CDK5 3..286 CDD:143344 160/293 (55%)
CDC28NP_009718.3 STKc_CDK1_CdkB_like 8..295 CDD:270829 160/292 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.