DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and CDKB2;2

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_173517.1 Gene:CDKB2;2 / 838687 AraportID:AT1G20930 Length:315 Species:Arabidopsis thaliana


Alignment Length:298 Identity:153/298 - (51%)
Similarity:199/298 - (66%) Gaps:12/298 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKEL-KHKNIV 64
            |:.::|:||:||||||.|::.|.:.|..|||||:.||.||:||||.:.||||.:|:.| :..:||
plant    13 MEAFEKLEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGVPPTTLREISILRMLARDPHIV 77

  Fly    65 RLIDVLHSDKK-----LTLVFEHCDQDLKKY---FDSLNGEIDMAVCRSFMLQLLRGLAFCHSHN 121
            ||:||.....|     |.||||:.|.||||:   |......|.....:..|.||.:|:||||.|.
plant    78 RLMDVKQGINKEGKTVLYLVFEYVDTDLKKFIRSFRQAGQNIPQNTVKCLMYQLCKGMAFCHGHG 142

  Fly   122 VLHRDLKPQNLLIN-KNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDM 185
            ||||||||.|||:: |...||:||.||||||.:|:|.|:.|::|||||.|:||.||..|:|.:||
plant   143 VLHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKYTHEILTLWYRAPEVLLGATHYSTGVDM 207

  Fly   186 WSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSWSQ 250
            ||.|||.|||. ..:.:|.|...|.||::|||:||||||:.|||||.|.|:...|.:..: |.|.
plant   208 WSVGCIFAELV-TKQAIFAGDSELQQLLRIFRLLGTPNEEVWPGVSKLKDWHEYPQWKPL-SLST 270

  Fly   251 LVPRLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTD 288
            .||.|:..|.|||.|:|...|.:||||:.||:||||.|
plant   271 AVPNLDEAGLDLLSKMLEYEPAKRISAKKAMEHPYFDD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 152/296 (51%)
STKc_CDK5 3..286 CDD:143344 149/292 (51%)
CDKB2;2NP_173517.1 PKc_like 14..307 CDD:389743 150/294 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.