DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and CDKB1;1

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_190986.1 Gene:CDKB1;1 / 824585 AraportID:AT3G54180 Length:309 Species:Arabidopsis thaliana


Alignment Length:314 Identity:150/314 - (47%)
Similarity:198/314 - (63%) Gaps:29/314 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHK-NIV 64
            |:||:|:||:||||||.|:|...:.|.::||||:.||:.|:||:|.:|||||.||:.|... .:|
plant     1 MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIYVV 65

  Fly    65 RLIDVLH----------SDKKLTLVFEHCDQDLKKYFDSLN-----GEIDMAVCRSFMLQLLRGL 114
            ||:.|.|          :...|.||||:.|.||||:.||..     ..::..:.:..|.||.:|:
plant    66 RLLCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKGV 130

  Fly   115 AFCHSHNVLHRDLKPQNLLINKNGE-LKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKL 178
            |.||||.||||||||||||:.|:.| ||:||.||.|||.:|:|.|:.|:||||||.|:||.|:..
plant   131 AHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTH 195

  Fly   179 YTTSIDMWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFP 243
            |:|.:||||.|||.||:. ..:.||||.....||:.|||:||||.|..|||||.|.|:...|   
plant   196 YSTGVDMWSVGCIFAEMV-RRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVSTLRDWHVYP--- 256

  Fly   244 AITSW-----SQLVPRLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTDSSSS 292
               .|     :..||.|:.:|.|||.|:|...|.:||||:.|:.||||.....|
plant   257 ---KWEPQDLTLAVPSLSPQGVDLLTKMLKYNPAERISAKTALDHPYFDSLDKS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 149/308 (48%)
STKc_CDK5 3..286 CDD:143344 146/304 (48%)
CDKB1;1NP_190986.1 PKc_like 2..302 CDD:419665 147/306 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.