DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and CDK15

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001353315.1 Gene:CDK15 / 65061 HGNCID:14434 Length:435 Species:Homo sapiens


Alignment Length:294 Identity:151/294 - (51%)
Similarity:197/294 - (67%) Gaps:18/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVRLID 68
            |..:||:|||:|.||:||.:|...::||||.:.::. :||||.:|:||..|||.|||.|||.|.|
Human   103 YLNLEKLGEGSYATVYKGISRINGQLVALKVISMNA-EEGVPFTAIREASLLKGLKHANIVLLHD 166

  Fly    69 VLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLKPQNLL 133
            ::|:.:.||.|||:...||.:|.....|.:.....|.||.|||||||:.|..:||||||||||||
Human   167 IIHTKETLTFVFEYMHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLL 231

  Fly   134 INKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILAELADA 198
            |:..|||||||||||||..||.:.||:|||||||||||.|.||..|::.:|:|.||||..|:.. 
Human   232 ISHLGELKLADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQ- 295

  Fly   199 GRPLFPG-SDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPS-FPAITS------WSQL--VP 253
            |:||||| |::|:||.||:.|||.|.||:|||||.|.:|  .|. ||..|.      |::|  ||
Human   296 GQPLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNY--NPEWFPLPTPRSLHVVWNRLGRVP 358

  Fly   254 RLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFT 287
                :..||..::|...|..|:||:.|:.|.||:
Human   359 ----EAEDLASQMLKGFPRDRVSAQEALVHDYFS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 151/294 (51%)
STKc_CDK5 3..286 CDD:143344 149/291 (51%)
CDK15NP_001353315.1 STKc_PFTAIRE2 102..387 CDD:270852 149/291 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.