DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and Cdk1

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_062169.1 Gene:Cdk1 / 54237 RGDID:2319 Length:297 Species:Rattus norvegicus


Alignment Length:295 Identity:162/295 - (54%)
Similarity:212/295 - (71%) Gaps:13/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVR 65
            |:.|.|:|||||||||.|:|||:|.|.:|||:|::||:.::|||||:|:|||.|||||:|.|||.
  Rat     1 MEDYIKIEKIGEGTYGVVYKGRHRTTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVS 65

  Fly    66 LIDVLHSDKKLTLVFEHCDQDLKKYFDSL-NGE-IDMAVCRSFMLQLLRGLAFCHSHNVLHRDLK 128
            |.|||..|.:|.|:||....|||||.||: .|: :|.::.:|::.|:|:|:.||||..|||||||
  Rat    66 LQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCHSRRVLHRDLK 130

  Fly   129 PQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILA 193
            ||||||:..|.:||||||||||||||::.|:.||||||||.|:||.|:..|:|.:|:||.|.|.|
  Rat   131 PQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFA 195

  Fly   194 ELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSW-----SQLVP 253
            ||| ..:|||.|...:|||.:|||.|||||.:.||.|..|.||  ..:||   .|     :..|.
  Rat   196 ELA-TKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDY--KNTFP---KWKPGSLASHVK 254

  Fly   254 RLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTD 288
            .|:..|.|||.|:|:..|.:|||.:.|::||||.|
  Rat   255 NLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 161/293 (55%)
STKc_CDK5 3..286 CDD:143344 158/289 (55%)
Cdk1NP_062169.1 STKc_CDK1_euk 3..287 CDD:270845 158/289 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.