DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and CG6800

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:285 Identity:106/285 - (37%)
Similarity:160/285 - (56%) Gaps:17/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KYDKMEKIGEGTYGTVFKG----RNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNI 63
            :|..:||||||.:|.|||.    ||::    ||:|:|.|......:..:.||||..|:..|.:.|
  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKE----VAIKKVALKNKFGNIALNTLREIKTLQLCKSEYI 68

  Fly    64 VRLIDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLK 128
            :.:||:......|:||.|:....|.....|....:.....|.|..|:.:|:|:.|...::|||:|
  Fly    69 LDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIK 133

  Fly   129 PQNLLINKNGELKLADFGLARAFGIP---VKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGC 190
            |.||||:....||:|||||||.: .|   .:.||.:|.|.|||.|::|||::.|.|.:|||:|||
  Fly   134 PANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGC 197

  Fly   191 ILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDY--VALPSFPAITSWSQLVP 253
            ::||:. .|.|||.|:..::||..|.|.||:|..:.||.::.|.||  :..|:...| .|..|.|
  Fly   198 VVAEML-RGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGI-HWDNLFP 260

  Fly   254 R-LNSKGRDLLQKLLICRPNQRISA 277
            . .::...:|:..|::..|..|:.|
  Fly   261 SCTHAVEINLVSNLVVYNPKNRLKA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 106/285 (37%)
STKc_CDK5 3..286 CDD:143344 106/285 (37%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 106/285 (37%)
S_TKc 9..288 CDD:214567 106/284 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.