DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and Cdk12

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster


Alignment Length:302 Identity:122/302 - (40%)
Similarity:178/302 - (58%) Gaps:28/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVRLID 68
            ::.:.:|||||||.|:|.|:..|.::||||:|||:.:.||.|.:|:|||.:|::|.|:|||.|.:
  Fly   804 FEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLHE 868

  Fly    69 VLHSDKK-----------LTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNV 122
            :: :||:           ..||||:.|.||....:|...:.:.....|.|.|||.||.:||..|.
  Fly   869 IV-TDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNF 932

  Fly   123 LHRDLKPQNLLINKNGELKLADFGLARAFGIP--VKCYSAEVVTLWYRPPDVLFGAKLYTTSIDM 185
            ||||:|..|:|:|..|::|||||||||.:...  .:.|:.:|:|||||||::|.|.:.|..|||:
  Fly   933 LHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDV 997

  Fly   186 WSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSWSQ 250
            ||.||||.||. ..||||..:..:.||..|.::.|:|....||.|      :.||.|..:.....
  Fly   998 WSCGCILGELF-VKRPLFQANAEMAQLETISKICGSPVPAVWPNV------IKLPLFHTLKQKKT 1055

  Fly   251 LVPRLN-------SKGRDLLQKLLICRPNQRISAEAAMQHPY 285
            ...||.       :...|||.|:|...|::||:||.|::.|:
  Fly  1056 HRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPW 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 122/302 (40%)
STKc_CDK5 3..286 CDD:143344 122/302 (40%)
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 122/302 (40%)
S_TKc 804..1098 CDD:214567 122/302 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.