DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and CG7028

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster


Alignment Length:322 Identity:94/322 - (29%)
Similarity:151/322 - (46%) Gaps:54/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GEGTYGTVFKGRNRDTMEI-VALKRVRLDEDDEGVPSSALREICLLKELKHK------NIVRLID 68
            |:|.:..|.:||::...:. ||:|.:|   ::|.:..:.|||:.:||:|...      :.:||..
  Fly   599 GQGVFSNVVRGRDQARGQANVAIKIIR---NNEIMHKTGLRELEILKKLNDADPEDRFHCLRLYR 660

  Fly    69 VLHSDKKLTLVFE----HCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLKP 129
            .....:.|.:|||    :..:.||||  ..|..:.:...||:..||...|.......:||.|:||
  Fly   661 HFFHKQHLCMVFEPLAMNLREVLKKY--GKNVGLHIKAVRSYTQQLFLALKLLKKTGILHADIKP 723

  Fly   130 QNLLINKNG-ELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILA 193
            .|:|:|:|. .|||.|||.|.|  |.....:..:|:.:||.|:::.|.. |...||.|||||.:.
  Fly   724 DNILVNENNLILKLCDFGSASA--ISDNEITPYLVSRFYRSPEIILGIP-YDYGIDTWSAGCTIY 785

  Fly   194 ELADAGRPLFPGSDVLDQLMKIFR-VLG-TPN-------------EDSWPGVSHLSD-------Y 236
            ||. .|:.||.|.. .:|::|.|. |.| .||             :.|...:.|..|       .
  Fly   786 ELY-TGKILFSGKS-NNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNFLYHEIDKLTEREKI 848

  Fly   237 VALPSF-PAITSWSQLVPRLN---------SKGRDLLQKLLICRPNQRISAEAAMQHPYFTD 288
            |.:|.. |:.:...:|:...|         ::.:|||:.:....|.:|||...|:.||:..:
  Fly   849 VVMPVVKPSRSLQQELIADQNLPDDQHRKVTQLKDLLENMFALDPAKRISLNQALVHPFIQE 910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 94/320 (29%)
STKc_CDK5 3..286 CDD:143344 94/318 (30%)
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 94/318 (30%)
S_TKc 599..908 CDD:214567 94/318 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.