DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5 and Cdk1

DIOPT Version :9

Sequence 1:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_031685.2 Gene:Cdk1 / 12534 MGIID:88351 Length:297 Species:Mus musculus


Alignment Length:295 Identity:162/295 - (54%)
Similarity:212/295 - (71%) Gaps:13/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVR 65
            |:.|.|:|||||||||.|:|||:|.|.:|||:|::||:.::|||||:|:|||.|||||:|.|||.
Mouse     1 MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVS 65

  Fly    66 LIDVLHSDKKLTLVFEHCDQDLKKYFDSL-NGE-IDMAVCRSFMLQLLRGLAFCHSHNVLHRDLK 128
            |.|||..|.:|.|:||....|||||.||: .|: :|.::.:|::.|:|:|:.||||..|||||||
Mouse    66 LQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLHRDLK 130

  Fly   129 PQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILA 193
            ||||||:..|.:||||||||||||||::.|:.||||||||.|:||.|:..|:|.:|:||.|.|.|
Mouse   131 PQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFA 195

  Fly   194 ELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSW-----SQLVP 253
            ||| ..:|||.|...:|||.:|||.|||||.:.||.|..|.||  ..:||   .|     :..|.
Mouse   196 ELA-TKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDY--KNTFP---KWKPGSLASHVK 254

  Fly   254 RLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTD 288
            .|:..|.|||.|:|:..|.:|||.:.|::||||.|
Mouse   255 NLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 161/293 (55%)
STKc_CDK5 3..286 CDD:143344 158/289 (55%)
Cdk1NP_031685.2 PLN00009 1..293 CDD:177649 162/295 (55%)
STKc_CDK1_euk 3..287 CDD:270845 158/289 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.