DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and YPL264C

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_015059.1 Gene:YPL264C / 855864 SGDID:S000006185 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:43/221 - (19%)
Similarity:83/221 - (37%) Gaps:58/221 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 YFFQLALEMDEAAMITLVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIGGVVAITMNDLH 255
            ||..:.|.:.:|.:||.:|.|.:.|:..|      ..|:..:..:.:...::..|||.|......
Yeast   106 YFSLMYLSISDAVLITFMSPTLTIFLSFL------LLGEPFSKLEALGSLISFSGVVLIIRPTFL 164

  Fly   256 DTKMTRGVLLALFSAFFYAAYLVFVKRKSDTEEKVD-----IPLFFGFVGLWNMLLLWPIFFILH 315
            ..:.|:|                   ::|..::.|:     :.|....|.|..:..|..::.|:.
Yeast   165 FGEQTQG-------------------QQSPQDDIVETQNPKLRLIAIGVSLLGVCGLSSVYIIIR 210

  Fly   316 FTKIETFELPSQGQFALL-FLNGLVGTVLSEALWL--------WGCFLT---SSLI--------- 359
            :...:...:.|...|:|: .:...:|.:|..::.|        ||.||.   |..|         
Yeast   211 YIGNKAHAIMSVSYFSLVTTVVAALGVLLIPSMSLQLPHSWKQWGLFLNLGISGFIHQILLTMGI 275

  Fly   360 -------GTLAMSLQIPLAILFDVLL 378
                   |:|....|:..|:.:||:|
Yeast   276 QRERAGRGSLMTYTQVIYAVFWDVVL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 43/221 (19%)
EamA 260..403 CDD:279264 28/152 (18%)
YPL264CNP_015059.1 RhaT 15..325 CDD:223769 43/221 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.