DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and YMD8

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_013674.1 Gene:YMD8 / 854970 SGDID:S000004502 Length:442 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:71/360 - (19%)
Similarity:116/360 - (32%) Gaps:122/360 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 HEATDALMARLSYAASLRIRRQKTHHKTAKTAL-----------LFCLLWFA---------ANYF 192
            |:||..|::.:..         |..||..|..|           |..||..|         :|..
Yeast    46 HQATLWLLSGIYI---------KLRHKPVKNVLRKNNGFNWSFFLKFLLPTAVASAGDIGLSNVS 101

  Fly   193 FQLALEMDEAAMITLVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIGGVVAITMNDLHDT 257
            ||..    ...:.|::.|:|..|::....:|..   :|......::|.:...||..:.......|
Yeast   102 FQYV----PLTIYTIIKSSSIAFVLLFGCIFKL---EKFHWKLALSVIIMFVGVALMVFKPSDST 159

  Fly   258 KMTRGVLLALFSAFFYAA----------YLVFVKRK-------------------SDTEEKVD-I 292
            .......|.:|.:|...|          |...:.|.                   ::.|:.|| .
Yeast   160 STKNDQALVIFGSFLVLASSCLSGLRWVYTQLMLRNNPIQTNTAAAVEESDGALFTENEDNVDNE 224

  Fly   293 PLFFGFVGLWNMLLL--------WPIFF------ILHFTKIET---FELPSQGQFA-----LLFL 335
            |:    |.|.|..:|        .||..      |:..|.:.|   .|.|..|.|:     |...
Yeast   225 PV----VNLANNKMLENFGESKPHPIHTIHQLAPIMGITLLLTSLLVEKPFPGIFSSSIFRLDTS 285

  Fly   336 NGLVG---TVLS-------------EALWLWGC---------FLTSSLIGTLAMSLQIPLAILFD 375
            ||.||   ||||             ....|..|         .||.|::| :...|   |.::|.
Yeast   286 NGGVGTETTVLSIVRGIVLLILPGFAVFLLTICEFSILEQTPVLTVSIVG-IVKEL---LTVIFG 346

  Fly   376 VLLKNKPYSPMF-YMGSIPIFVALVFVSLLMRNDD 409
            :::.::..|..: ::|.:.|...:.:.:......|
Yeast   347 IIILSERLSGFYNWLGMLIIMADVCYYNYFRYKQD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 67/343 (20%)
EamA 260..403 CDD:279264 44/220 (20%)
YMD8NP_013674.1 TPT_S35C2 77..371 CDD:411044 61/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.