DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35a5

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_006522710.1 Gene:Slc35a5 / 74102 MGIID:1921352 Length:453 Species:Mus musculus


Alignment Length:274 Identity:45/274 - (16%)
Similarity:104/274 - (37%) Gaps:98/274 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 TALLFCLL---------WFAANYFFQLALEMDEAAMITLVSST--------------SSFFI--- 216
            |||||.::         |.:....|        .:::.|.:||              .:||.   
Mouse   163 TALLFRIVLKRHLNWIQWASLLILF--------LSIVALTASTKTSQHELAGHGFHHDAFFTPSN 219

  Fly   217 ICL-----AAVFPSATGDKLTITKV---------IAVAMNIGGVVAI------TMNDLHD----- 256
            .||     .::..:.|..:.|.::|         ..:.:.:|.|:.|      :|.::::     
Mouse   220 SCLHFRRDCSLRDNCTSKEWTFSEVQWNTTARVFSHIRLGLGHVLIIVQCFISSMANIYNEKILK 284

  Fly   257 --TKMTRGVLLALFSAFFYAAY---LVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIFFILHF 316
              |::|..:.:.....:|:...   |..|.:.|:.::..:...|:|. ..::::|:    |:..|
Mouse   285 EGTQLTESIFIQNSKLYFFGIVFNGLTLVLQSSNRDQIQNCGFFYGH-NAFSVVLI----FVTAF 344

  Fly   317 TKIETFELPSQGQFALLFLNGLVGTVLSEALWLWGCFLTSSLIGTLAM-----------SLQIPL 370
            ..:..       .|.|.||:.:...::::        :|:.:|.|:::           .|:.| 
Mouse   345 QGLSV-------AFILKFLDNMFHVLMAQ--------VTTVIITTVSVLVFDFRPSLDFFLEAP- 393

  Fly   371 AILFDVLLKN--KP 382
            ::|..:.:.|  ||
Mouse   394 SVLLSIFIYNASKP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 45/274 (16%)
EamA 260..403 CDD:279264 23/139 (17%)
Slc35a5XP_006522710.1 Nuc_sug_transp 46..403 CDD:282054 42/268 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.