DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and SLC35A2

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001269580.1 Gene:SLC35A2 / 7355 HGNCID:11022 Length:421 Species:Homo sapiens


Alignment Length:401 Identity:77/401 - (19%)
Similarity:126/401 - (31%) Gaps:155/401 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LGAGGQSNGTSNS---ISGTESD-----------DSSV-----RSVRFSKMAEVREMSAHEATDA 153
            :.||....||:::   ::..|::           |:||     |.:::..:|.:...:|     :
Human    18 VSAGALEPGTASAELLLTWEEAEARGQGLPQPLPDTSVRIPAHRRLKYISLAVLVVQNA-----S 77

  Fly   154 LMARLSYAASLRIRRQKTHHKTAKTAL--------LFCLLWFAA---NYFFQLALEMDEAAMITL 207
            |:..:.||.:|...|     ..|.||:        |.|||...|   .....|.|.:.||.::..
Human    78 LILSIRYARTLPGDR-----FFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQY 137

  Fly   208 VSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMN------IGGVVAITMNDLHDTKMTRGVLLA 266
            |.:.                  ||.:..:|....|      |..:.|.|....:..|:   :..|
Human   138 VDTL------------------KLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKI---LTTA 181

  Fly   267 LFSAFF---------YAAYLVFV---------------KRKSDTEEKVDIP------LFFGFVGL 301
            |||...         :|:.|:..               .|..|......:.      |..||.|:
Human   182 LFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGV 246

  Fly   302 WNMLLLWPIFFILHFTKIETFELPSQGQFALLFLN----GLVGTVLS-EALW------------- 348
            :                   ||...:|....::|.    ||.||.|. ..||             
Human   247 Y-------------------FEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFF 292

  Fly   349 ------LWGCFLTSSLIGTL---------------AMSLQIPLAILFDVLLKNKPYSPMFYMGSI 392
                  :||..|..:..|.|               |.||.|.|:.:..:.|......|:|.:|:.
Human   293 FGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAG 357

  Fly   393 PIFVALVFVSL 403
            .:..|:...||
Human   358 LVIGAVYLYSL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 64/331 (19%)
EamA 260..403 CDD:279264 38/211 (18%)
SLC35A2NP_001269580.1 Nuc_sug_transp 59..367 CDD:282054 67/357 (19%)
nst 142..366 CDD:129885 46/245 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.