DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and SLC35A5

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001335834.1 Gene:SLC35A5 / 55032 HGNCID:20792 Length:424 Species:Homo sapiens


Alignment Length:169 Identity:39/169 - (23%)
Similarity:67/169 - (39%) Gaps:42/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 LVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIGGVVAITMNDLHDTKMTRGVLLALFS-- 269
            ::.|.|:.:...|.|:|.:.:..::.:.|..|...|....:..|:|..  :::.:.|...|.|  
Human    10 VICSLSTMYTFLLGAIFIALSSSRILLVKYSANEENKYDYLPTTVNVC--SELVKLVFCVLVSFC 72

  Fly   270 ---------AFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIFFILHFTKIETFELP 325
                     ...||::    |..||. .|..||.|..|  |.|::    :|::|.:.        
Human    73 VIKKDHQSRNLKYASW----KEFSDF-MKWSIPAFLYF--LDNLI----VFYVLSYL-------- 118

  Fly   326 SQGQFALLFLNGLVGT-------VLSEAL-WL-WGCFLT 355
             |...|::|.|..:.|       ||...| |: |...||
Human   119 -QPAMAVIFSNFSIITTALLFRIVLKRRLNWIQWASLLT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 39/169 (23%)
EamA 260..403 CDD:279264 29/116 (25%)
SLC35A5NP_001335834.1 Nuc_sug_transp 24..374 CDD:282054 36/155 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.