DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35f1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001102808.1 Gene:Slc35f1 / 502421 RGDID:1559576 Length:408 Species:Rattus norvegicus


Alignment Length:256 Identity:51/256 - (19%)
Similarity:93/256 - (36%) Gaps:79/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LSYAASLRIRRQKTHHKTAKTALL------FCLLWF---AANYFFQLA--------LEMDEAAMI 205
            |.|..:|.:|:.:.:    ..|:|      :.:|.|   .|||....|        :::.:..:|
  Rat   106 LVYTTTLAVRQGEEN----LLAILRRRWWKYMILGFIDLEANYLVVKAYQYTTLTSVQLLDCFVI 166

  Fly   206 TLVSSTSSFF-------------IICLAAVFPSATGDKLT-------ITKVIAVAMNIGGVVAIT 250
            .:|...|.||             ::|:..:......|.|.       ..|::...:.:||.....
  Rat   167 PVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAGENKLVGDLLVLGGATLYG 231

  Fly   251 MNDLHDTKMTRGV-------LLALFSAFFYAAYLVFVKRKSDTEEKVDIP-------LFFGF--- 298
            ::::.:..:.|.:       ::.||.|||....|..::.|    |.:.:|       |:.||   
  Rat   232 ISNVWEESIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHK----ELLKVPWDWQIGLLYVGFSAC 292

  Fly   299 -VGLW---------------NMLLLWPIFFILHFTKIETFELPSQGQFALLFLNGLVGTVL 343
             .||:               |:.||....:.| |..:..|.....|.:.|.|...|:|.||
  Rat   293 MFGLYSFMPVVIKKTSATSVNLSLLTADLYSL-FCGLFLFHYKFSGLYLLSFFTILIGLVL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 51/256 (20%)
EamA 260..403 CDD:279264 28/117 (24%)
Slc35f1NP_001102808.1 SLC35F 56..355 CDD:283644 51/256 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.