DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35a5

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_006248404.1 Gene:Slc35a5 / 498081 RGDID:1564361 Length:454 Species:Rattus norvegicus


Alignment Length:213 Identity:37/213 - (17%)
Similarity:79/213 - (37%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SFFIICLAAVFPSATGDKLTITKVIAVAMNIGGVVAITMNDLHDTKMTRGVLLALFSAFFYAAYL 277
            :.:...|..:|.:.:..::.:.|..|...|....:..|:|..  :::.:.:|..|.|       |
  Rat    45 TLYTFLLGVIFITLSSSRILLVKYSANEENKYDYLPTTVNVC--SELMKLILCILVS-------L 100

  Fly   278 VFVKRKSDTEEKV--------------DIPLFFGFVGLWNMLLLWPIFFILHFTKIETFELPSQG 328
            ..||::....:.|              .||.|..|  |.|::    :|::|.:.         |.
  Rat   101 CIVKKEDHQSKHVRCTSWKEFSGFLKWSIPAFLYF--LDNLI----VFYVLSYL---------QP 150

  Fly   329 QFALLFLNGLVGTVLSEALWLWGCFLTSSLIGTLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIP 393
            ..|::|.|                   .|:|.|         |:||.::|| :..:.:.:...:.
  Rat   151 AMAVIFSN-------------------FSIITT---------ALLFRIVLK-RHLNWIQWASLLI 186

  Fly   394 IFVALVFVSLLMRNDDSD 411
            :|:::|.::...:....|
  Rat   187 LFLSIVALTASTKTSQHD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 35/199 (18%)
EamA 260..403 CDD:279264 29/156 (19%)
Slc35a5XP_006248404.1 Nuc_sug_transp 53..404 CDD:282054 36/205 (18%)
EamA <131..192 CDD:304911 19/104 (18%)
EamA <244..403 CDD:304911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.