Sequence 1: | NP_611049.1 | Gene: | CG8195 / 36725 | FlyBaseID: | FBgn0034032 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097853.1 | Gene: | meigo / 42510 | FlyBaseID: | FBgn0250820 | Length: | 338 | Species: | Drosophila melanogaster |
Alignment Length: | 257 | Identity: | 53/257 - (20%) |
---|---|---|---|
Similarity: | 81/257 - (31%) | Gaps: | 99/257 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 LTITKVIAVAMNIGGVVAITMNDLHDTKMTRGVLLALFS---AFFYAAYLVFVKRKSDTEEKVDI 292
Fly 293 PLFFGFVG----LWN------MLLLWPIFFILHFTKIETFELPSQ----GQFALLFL----NGLV 339
Fly 340 GTV--------------LSEALWLWG------------------------------------C-- 352
Fly 353 ------FLTSSLIGTLAMSLQIP----LAILFDVLLKNKPYSPMFYMGSIPIFVALVFVSLL 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8195 | NP_611049.1 | 2A78 | 153..399 | CDD:273359 | 49/250 (20%) |
EamA | 260..403 | CDD:279264 | 45/225 (20%) | ||
meigo | NP_001097853.1 | UAA | 8..311 | CDD:285625 | 52/255 (20%) |
EamA | 169..308 | CDD:304911 | 26/140 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0697 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |