DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and meigo

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001097853.1 Gene:meigo / 42510 FlyBaseID:FBgn0250820 Length:338 Species:Drosophila melanogaster


Alignment Length:257 Identity:53/257 - (20%)
Similarity:81/257 - (31%) Gaps:99/257 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LTITKVIAVAMNIGGVVAITMNDLHDTKMTRGVLLALFS---AFFYAAYLVFVKRKSDTEEKVDI 292
            |||........|.|..||.::.          .|||:.|   |..:..|...|..||  .:.:.:
  Fly    71 LTIRPQKEDTTNAGSYVACSLT----------YLLAMVSTNMAMRWVPYPTAVVGKS--AKPIPV 123

  Fly   293 PLFFGFVG----LWN------MLLLWPIFFILHFTKIETFELPSQ----GQFALLFL----NGLV 339
            .:....:|    .|.      .::|..|.|:....|:.  .||::    |: .||||    :||.
  Fly   124 MILGVLIGRKSYSWTRYACVLTIVLGVILFMYKEGKVS--NLPAETTLLGE-VLLFLSLSMDGLT 185

  Fly   340 GTV--------------LSEALWLWG------------------------------------C-- 352
            |.|              :..|:..|.                                    |  
  Fly   186 GAVQERIRAASAPSGQQMMRAMNFWSTLMLGVAMVFTGEAKEFMYFTIRHPEAWTHLSLIAVCGV 250

  Fly   353 ------FLTSSLIGTLAMSLQIP----LAILFDVLLKNKPYSPMFYMGSIPIFVALVFVSLL 404
                  ||..:..|.||.|:...    ..:|..|||.........::|::.:|.|| ||.:|
  Fly   251 LGQFFIFLMVASFGPLACSVVTTTRKFFTVLCSVLLFGNVLIARQWLGAVLVFAAL-FVDML 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 49/250 (20%)
EamA 260..403 CDD:279264 45/225 (20%)
meigoNP_001097853.1 UAA 8..311 CDD:285625 52/255 (20%)
EamA 169..308 CDD:304911 26/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.