DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and sll

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001247153.1 Gene:sll / 42115 FlyBaseID:FBgn0038524 Length:465 Species:Drosophila melanogaster


Alignment Length:263 Identity:53/263 - (20%)
Similarity:96/263 - (36%) Gaps:68/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 AAVFPSATGDKLTITKVIAVAMNIGGVVA--ITMNDLHDTKMTRGVL-------------LALFS 269
            |:..|..|..:    :.:.:....||::.  :|...|.:..||:..|             ..:||
  Fly   130 ASTAPKRTSSQ----EAVQLLWCFGGLMISYLTWGVLQEKIMTQNYLNFTGESAKFKDSQFLVFS 190

  Fly   270 ----AFFYA-AYLVFVKRKSDTEEKVDIPLF-FGFVGLWNMLLLWPIFFILHFTKIETFELPSQG 328
                ||..| |||.:  :.|....:.  ||: :.:....|::..|..:..|.|....|..|....
  Fly   191 NRLLAFLVALAYLQW--QPSPVRHRA--PLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSC 251

  Fly   329 QFALLFLNGLVGTVLSEALWLWGCFLTSSLIG--------------------TLAMSLQIPLAIL 373
            :...:.   |:|.::|:|.:....::|:.||.                    ||.....:.:.::
  Fly   252 KIIPVM---LMGKIMSKAKYESYEYVTALLISLGMIFFMSGSSDSSKASGVTTLTGIFLLSMYMV 313

  Fly   374 FDVLLKN------KPY--SPMFYMGSIPIFVAL-VFVSLLMRNDDSDPL-------MKLFRIVYR 422
            ||....|      |.|  :|:..|..:.:|.:: ...||.|:....|.|       ..:|.:|..
  Fly   314 FDSFTANWQGSLFKSYGMTPLQMMCGVNLFSSIFTGASLSMQGGFMDSLAFATEHPKFVFDMVVL 378

  Fly   423 KVC 425
            .||
  Fly   379 SVC 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 44/228 (19%)
EamA 260..403 CDD:279264 36/190 (19%)
sllNP_001247153.1 UAA 144..444 CDD:285625 50/245 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.