DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and CG14971

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_647817.2 Gene:CG14971 / 38429 FlyBaseID:FBgn0035449 Length:469 Species:Drosophila melanogaster


Alignment Length:362 Identity:70/362 - (19%)
Similarity:123/362 - (33%) Gaps:117/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VPIRSPHLGAGGQSNGTSNSISGTESDDSSVRSVRFSKMAEVREMSAHEATDALMARLSYAASLR 165
            |..:...|...|::.|..|   |..||            ||..|:..|     |..:.......|
  Fly     2 VAAKYERLNTSGEAAGNGN---GNASD------------AEDEEIELH-----LAQKTQLGNGHR 46

  Fly   166 IRRQKTHHKTAK-----------TALLF---CLLWFA----ANYFFQLALEMDEAAMITLVSSTS 212
            :|:....:.:.|           ||.|.   .::..|    |..|..|||.:......|.::...
  Fly    47 LRQSNFKYASGKCGSGEAPCTNETATLAQENMMMQMAVGTLAIIFLYLALSISLTFYQTDINRQM 111

  Fly   213 SF------------FIICLAA--VFPSATGD-------KLTITKV----IAVAMNIG----GVVA 248
            .|            |::..||  ::....|.       :|.:.|:    :|.|::||    |:..
  Fly   112 PFPLAIVTYHLVVKFLLAAAARRIYRMRVGRSRVQLDWRLALRKMAPTGVASAIDIGFSNWGLAL 176

  Fly   249 ITMNDLHDTKMTRGVLLALFSAFF----YAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWP 309
            :.::....||.:..|.:.||:..|    .:.|||.:               .|.:|..       
  Fly   177 VPISLYTMTKSSTIVFILLFAIAFGLEKKSWYLVSI---------------VGLIGTG------- 219

  Fly   310 IFFILHFTKIETFELPSQGQFALLFLNGLVGTVLSEAL-WLWGCF-LTSSLIGTLAMSLQIPLAI 372
               :|.||...| :..:.|.|.:||.:      ||..| |.:..| :..|.:|     |..|:.:
  Fly   220 ---LLMFTYKST-DFNALGFFFILFAS------LSSGLRWSFAQFIMQKSKLG-----LHNPIDM 269

  Fly   373 LFDVLLKNKPYSPMFYMGSIPIFVALVFVSLLMRNDD 409
            ::.:       .|......:|:.:.:....|:...:|
  Fly   270 IYYM-------QPWMIASLVPLVIGIEGAGLIAVIED 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 56/298 (19%)
EamA 260..403 CDD:279264 28/148 (19%)
CG14971NP_647817.2 TPT 86..382 CDD:281186 50/258 (19%)
PMT_2 111..325 CDD:304453 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.