DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and slc35a5

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_005167880.1 Gene:slc35a5 / 368418 ZFINID:ZDB-GENE-030616-55 Length:463 Species:Danio rerio


Alignment Length:188 Identity:43/188 - (22%)
Similarity:68/188 - (36%) Gaps:55/188 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LLFCLLWFAANYFFQLALEMDEAAMITLVSSTSSFFIICLAAVFPSAT----GDKLTIT------ 234
            ||.|.:...||.:.:..|:..|..:.::....|..::..|  ||.|.|    .|...:|      
Zfish   275 LLQCFISALANIYNEKILKEGEQLVESIFIQNSKLYLFGL--VFNSLTLLLHADYRNLTLHCGIL 337

  Fly   235 ---KVIAVAMN-----IGGVVAITM----NDLH--DTKMTRGVLLALFSAFFYAAYLVFVKRKSD 285
               .|.:||:.     :|..||..:    |..|  ..::|..|:.||  :||             
Zfish   338 YGHNVFSVALGFVTAALGLSVAFILKFRDNMFHVLTGQITTVVVTAL--SFF------------- 387

  Fly   286 TEEKVDIPLFFGFVGLWNMLLLWPI----FFILHFTKIETFELPSQGQFALLFLNGLV 339
                     .|.|....:..:..|:    .||.|.:|::..|...| |..|..:||.|
Zfish   388 ---------LFDFQPSMDFFMQAPVVLLSIFIYHSSKMKDPEYALQ-QERLRVINGEV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 43/188 (23%)
EamA 260..403 CDD:279264 20/84 (24%)
slc35a5XP_005167880.1 Nuc_sug_transp 72..411 CDD:282054 33/161 (20%)
EamA 138..411 CDD:304911 33/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.