DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and senju

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_608902.1 Gene:senju / 33734 FlyBaseID:FBgn0031676 Length:388 Species:Drosophila melanogaster


Alignment Length:160 Identity:33/160 - (20%)
Similarity:71/160 - (44%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 YAAYLVFVKRKSDTEEKVDIPLFFGFVGLW-NMLLLWPIFFILHFTKIETFELPSQG---QFALL 333
            |..||:       .::..|:.:|...|.:: :.::...:..:|....::.|...:.|   :|::|
  Fly   222 YNEYLL-------KDKGADVNIFVQNVFMYLDSIVCNAVILLLRGELLDAFSPQNLGSIMRFSVL 279

  Fly   334 FL---NGLVGTVLSEALWLWGCFL--TSSLIGTLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIP 393
            .:   |..:|.|.|       .||  .:|::.|.|.:|:    :||..:|       .:::.|||
  Fly   280 IIIVNNAAIGIVTS-------FFLKYMNSILKTFASALE----LLFTAVL-------CYFLFSIP 326

  Fly   394 IF----VALVFVSLLMRNDDSDPLMKLFRI 419
            |:    :|:..||..:......|::.|.::
  Fly   327 IYMNTALAIAVVSYAIYLYTQSPVVNLGKV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 29/138 (21%)
EamA 260..403 CDD:279264 30/142 (21%)
senjuNP_608902.1 Nuc_sug_transp 44..346 CDD:282054 31/148 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.