DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35a1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_006238058.1 Gene:Slc35a1 / 313139 RGDID:1311359 Length:336 Species:Rattus norvegicus


Alignment Length:261 Identity:47/261 - (18%)
Similarity:86/261 - (32%) Gaps:82/261 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LLWFAANYFFQLALEMDEAAMITLVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIGGVVA 248
            |::...|....|||...:||:..:   |....|.|.|..........|:..:.|:|.|..|||..
  Rat    96 LVYAVQNNMAFLALSNLDAAVYQV---TYQLKIPCTALCTVLMLNRSLSKLQWISVFMLCGGVTL 157

  Fly   249 ITMNDLHDTKMT---------RGVLLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNM 304
            :.......||:.         ..:.:|:..:.|...|...|.:.|||.                 
  Rat   158 VQWKPAQATKVVVAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTS----------------- 205

  Fly   305 LLLWPIFFILHFTKIETFELPSQGQFALLFLNG----LVGTVLSE-------------ALWLW-- 350
              ||          :...:         ::|:|    |.||.||:             ..::|  
  Rat   206 --LW----------VRNIQ---------MYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFV 249

  Fly   351 -------GCF------LTSSLIGTLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIPIFVALVFVS 402
                   |.:      .|.:::...:.:..|.|:.:..|:|.....:..|.:|::.:.|::....
  Rat   250 IFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLYG 314

  Fly   403 L 403
            |
  Rat   315 L 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 46/255 (18%)
EamA 260..403 CDD:279264 26/183 (14%)
Slc35a1XP_006238058.1 Nuc_sug_transp 8..314 CDD:282054 46/258 (18%)
nst 90..313 CDD:129885 46/257 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.