DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Ugalt

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster


Alignment Length:313 Identity:66/313 - (21%)
Similarity:99/313 - (31%) Gaps:113/313 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LMARLSYAASLRIRRQKTHHKTAKTALLFCLLWFAANYFFQLALEMDEAAM------------IT 206
            |.|.::|:.|         |:|.....|        .|...|.|.:..|.:            ..
  Fly     4 LPAPVTYSYS---------HRTVNANTL--------KYISLLTLTLQNAILGLSMRYARTRPGDI 51

  Fly   207 LVSSTS------SFFIICLAAVFPSATGDKLTITK-----VIAVAMN-----IGGVVAITMNDL- 254
            .:|||:      :..|.||..||.....|.....:     :||..|:     :..:|.|..|:| 
  Fly    52 FLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLL 116

  Fly   255 -----HDTKMTRGV---LLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIF 311
                 |....|..|   |..|.:|.|  |.::..::..:|:              |..|||..:.
  Fly   117 YVSASHLDAATYQVTYQLKILTTAMF--AVVILRRKLLNTQ--------------WGALLLLVMG 165

  Fly   312 FILHFTKIETFELPSQGQFALLFLNGLVGTVLSEA------------LW--LWGCFLTSSLIGTL 362
            .:|  .::...|.|:.|.     ..|......:.:            ||  |..||| |...|  
  Fly   166 IVL--VQLAQTEGPTSGS-----AGGAAAAATAASSGGAPEQNRMLGLWAALGACFL-SGFAG-- 220

  Fly   363 AMSLQIPLAILFDVLLKNKPYS-----PMFYMGSIPIFVALVFVSLLMRNDDS 410
                     |.|:.:||....|     ....:.|||..:...||     ||.|
  Fly   221 ---------IYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFV-----NDGS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 61/300 (20%)
EamA 260..403 CDD:279264 35/164 (21%)
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 60/290 (21%)
EamA 101..341 CDD:304911 43/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.