DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35c2

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001101273.1 Gene:Slc35c2 / 311637 RGDID:1311250 Length:364 Species:Rattus norvegicus


Alignment Length:255 Identity:55/255 - (21%)
Similarity:93/255 - (36%) Gaps:81/255 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 WFAANYFFQLALEMDEAAMITLVSSTSSFFIIC--------------LAAVFPSATGDKLTITKV 236
            |...::.|.|.:.|...|:|.|.|:.|...:.|              |..|.|:|          
  Rat    37 WLTKSFHFPLFMTMLHLAVIFLFSALSRALVQCSSHRARVVLSWTDYLRRVAPTA---------- 91

  Fly   237 IAVAMNIG----GVVAITMNDLHDTKMTRGVLLALFSAFF----YAAYLVFVKRKSDTEEKVDIP 293
            :|.|:::|    ..:.||::....||.:..:.:.:||..|    ..|.||.|             
  Rat    92 LATALDVGLSNWSFLYITVSLYTMTKSSAVLFILIFSLIFKLEELRAALVLV------------- 143

  Fly   294 LFFGFVGLWNMLLLWPIFFILHFTKIETFELPSQGQFALLFLNGLVGTVLSEALWLWGCFLTSSL 358
                      :||:....|:..: |...|.:..   |||:.....:|.:    .|.    ||..|
  Rat   144 ----------VLLIAGGLFMFTY-KSTQFNVEG---FALVLGASFIGGI----RWT----LTQML 186

  Fly   359 IGTLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIPIFVALVFVSLLMRNDDSDPLMKLFR 418
            :....:.||.|:..:|.:       .|:.::|..|:|.  ||..|.:...:     |:||
  Rat   187 LQKADLGLQNPIDTMFHL-------QPLMFLGLFPLFA--VFEGLHLSTSE-----KIFR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 49/234 (21%)
EamA 260..403 CDD:279264 30/146 (21%)
Slc35c2NP_001101273.1 TPT 16..313 CDD:281186 55/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.