DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35b3

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_225253.5 Gene:Slc35b3 / 306866 RGDID:1307183 Length:411 Species:Rattus norvegicus


Alignment Length:280 Identity:63/280 - (22%)
Similarity:109/280 - (38%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LRIRRQKTHHKTAKTALLFCLLWFAANYFFQLALEMDEAAMITLVSSTSSFFIIC------LAAV 222
            |::.:.|......||.::...|...       .:.:...::..|...|...|..|      |..|
  Rat   141 LQLTQDKRRRIPGKTYMIIAFLTVG-------TMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGV 198

  Fly   223 FPSATGDKLTITKV-IAVAMNIGGVVAITMND---LHDTKMTRGVLLALFSAFFYAAYLVFVKRK 283
            |  ..|.:..:..| .||.|:: |::..|:.|   ..:..:|..:|::|  |....|.:..|:.|
  Rat   199 F--IQGKRYNLADVSAAVCMSL-GLIWFTLADSTIAPNFNLTGVMLISL--ALCADAVIGNVQEK 258

  Fly   284 ------SDTEEKVDIPLFFGFV----GLWNMLLLWPIFFILHFTKIETFELPSQGQFALLF-LNG 337
                  :...|.|......|||    ||.....|.|.........:.|:      .:|.|| |.|
  Rat   259 AMKLHNASNSEMVLYSYSIGFVYILLGLSCTSGLGPALAFCSKNPVRTY------GYAFLFSLTG 317

  Fly   338 LVGTVLSEAL-WLWGCFLTSSL-IGTLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIPIFVALVF 400
            ..|.....|| .::|..|..:: .|..||:  |.|:.||..    ||:: ..|:.|..:.|..:|
  Rat   318 YFGISFVLALIKIFGALLAVTVTTGRKAMT--IVLSFLFFA----KPFT-FQYIWSGLLVVLGIF 375

  Fly   401 VSLLMRNDDSDPLMKLFRIV 420
            :::..:|.|...|..::.::
  Rat   376 LNVYSKNMDKIRLPSVYSVI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 59/257 (23%)
EamA 260..403 CDD:279264 40/155 (26%)
Slc35b3XP_225253.5 UAA 90..381 CDD:285625 60/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.