DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35f2

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001382663.1 Gene:Slc35f2 / 300713 RGDID:1311242 Length:375 Species:Rattus norvegicus


Alignment Length:261 Identity:55/261 - (21%)
Similarity:90/261 - (34%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LRIRRQKTHHKTAKTALLFCLLWFAANYFFQLALEMDEAAMITL-------VSSTSSFFI----- 216
            |.|.|:|....|     |..|....|||....|.:......:.|       |....|:||     
  Rat   101 LEILRRKWWKYT-----LLGLADVEANYLIVRAYQYTTLTSVQLLDCFGIPVLMALSWFILRARY 160

  Fly   217 --ICLAAVFPSATGDKLTITKVIAVAMNIGGVVAITMNDLHDTKMTRGVLLALFSAFFYAAYLV- 278
              |...|||....|          |...:|..:.....|...:.:..|.:|.|..|..||...| 
  Rat   161 KVIHFIAVFVCLLG----------VGTMVGADILAGREDNSGSDVLIGDILVLLGASLYAVSNVC 215

  Fly   279 --FVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIFFILHFTKIETFELPSQGQFALLFLNGLVGT 341
              ::.:|...:|      |.|.|||:..::......|:.:..|...:.  ..:.||||       
  Rat   216 EEYIVKKLSRQE------FLGMVGLFGTIISGIQLLIVEYKDIARIQW--DWKIALLF------- 265

  Fly   342 VLSEALWLWGCFLTSSLIGTLAMSLQIPLAIL--------FDVLLKNKPYSPMFYMGSIPIFVAL 398
             ::.||.::..:....|:..:..:..:.|.||        |.:.|....:|.::.:....|.|..
  Rat   266 -VAFALCMFCLYSFMPLVMKVTSATSVNLGILTADLYSLFFGLFLFEYKFSGLYILSFTVIMVGF 329

  Fly   399 V 399
            :
  Rat   330 I 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 55/259 (21%)
EamA 260..403 CDD:279264 31/151 (21%)
Slc35f2NP_001382663.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.