DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35b1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_954512.1 Gene:Slc35b1 / 287642 RGDID:727783 Length:322 Species:Rattus norvegicus


Alignment Length:107 Identity:29/107 - (27%)
Similarity:45/107 - (42%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 VGLWNMLLLWP-IFFILHFTKIETF--ELPSQGQFALLFLNGLVGTVLSEALWLWGCFLTSSLIG 360
            :.||:.:||.. |.|.....:..:|  ..|:.....|||       .|:.||.....|:|....|
  Rat   208 INLWSTVLLGAGILFTGELWEFLSFAERYPTIIYNILLF-------GLTSALGQSFIFMTVVYFG 265

  Fly   361 TLAMSLQIP----LAILFDVLLKNKPYSPMFYMGSIPIFVAL 398
            .|..|:...    ..||..|:|...|.|.|.::|::.:|:.|
  Rat   266 PLTCSIITTTRKFFTILASVILFANPISSMQWVGTVLVFLGL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 29/107 (27%)
EamA 260..403 CDD:279264 29/107 (27%)
Slc35b1NP_954512.1 UAA 16..309 CDD:285625 29/107 (27%)
EamA <205..309 CDD:304911 29/107 (27%)
Di-lysine motif 318..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.