DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35g1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_780716.1 Gene:Slc35g1 / 240660 MGIID:2444789 Length:368 Species:Mus musculus


Alignment Length:148 Identity:40/148 - (27%)
Similarity:67/148 - (45%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 GVLLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIFFILHFTKIETFELPS 326
            |:...:.|||.::...:||| |......|:|..|...|   .||::.|   .|.:.|  |..:..
Mouse    74 GLFYTVLSAFLFSVASLFVK-KVQGVHAVEISAFRCVV---QMLVIIP---CLIYRK--TGFIGP 129

  Fly   327 QGQFALLFLNGLVGTVLSEALWLWGCFLTSSLIGTLAMSLQIPL--AILFDVLLKNKPYS----- 384
            :||...|||.|:.|:  |..:.::..|.|:||.....::...|:  :|...:.||.| ||     
Mouse   130 KGQRLFLFLRGVFGS--SAMILMYYAFQTTSLADATVIAFSCPVFTSIFAWIFLKEK-YSLWDAF 191

  Fly   385 -PMFYMGSIPIFVALVFV 401
             .:|.:..:.:.|...|:
Mouse   192 FTLFAIAGVILIVRPPFI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 39/144 (27%)
EamA 260..403 CDD:279264 40/148 (27%)
Slc35g1NP_780716.1 EamA 72..205 CDD:279264 38/142 (27%)
RhaT 73..362 CDD:223769 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.