DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and SLC35A3

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001258614.1 Gene:SLC35A3 / 23443 HGNCID:11023 Length:367 Species:Homo sapiens


Alignment Length:373 Identity:71/373 - (19%)
Similarity:132/373 - (35%) Gaps:114/373 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SNGTSNSISGTESDDSSVRSVRFSKMAEVREMS----AHE------------------ATDALMA 156
            |....:.:.||::.|   :.:...|..|::||.    |:|                  .|.:|:.
Human     3 SRSVLSPVVGTDAPD---QHLELKKPQELKEMERLPLANEDKTMFANLKYVSLGILVFQTTSLVL 64

  Fly   157 RLSYAASLRIRRQKTHHKTAKTA-----LLFCLL------------------------------- 185
            .:.|:.:|:....:....||...     ::.|:|                               
Human    65 TMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKL 129

  Fly   186 ------WFAANYFFQLALEMDEAAMITLVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIG 244
                  :...|....:||...:||...:   |....|:..|....|....||.:.:.:::.:.:.
Human   130 AIPSGIYTLQNNLLYVALSNLDAATYQV---TYQLKILTTALFSVSMLSKKLGVYQWLSLVILMT 191

  Fly   245 GVVAI---TMNDLHDTKMTRG--------VLLALFSAFFYAAYLVFVKRKSDTEEKV---DIPL- 294
            ||..:   :.:.|...:::.|        ||.|.||:.|...|  |.|...:|::.|   :|.| 
Human   192 GVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVY--FEKILKETKQSVWIRNIQLG 254

  Fly   295 FFGFVGLWNMLLLWPIFFILHFTKIETFELPSQGQF---------ALLFLNGLVGTVLSEALWLW 350
            |||.:            |.|....|...||.|:..|         .::.|..|.|.|::..:   
Human   255 FFGSI------------FGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVI--- 304

  Fly   351 GCFLTSSLIGTLAMSLQIPLAILFDVL-LKNKPYSPMFYMGSIPIFVA 397
              ....:::...|.||.|.|:.|.... |::...:.:|::|:|.:..|
Human   305 --KYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITA 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 60/312 (19%)
EamA 260..403 CDD:279264 39/160 (24%)
SLC35A3NP_001258614.1 Nuc_sug_transp 46..355 CDD:282054 61/327 (19%)
nst 128..354 CDD:129885 53/245 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.