DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35a3

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_006501488.1 Gene:Slc35a3 / 229782 MGIID:1917648 Length:338 Species:Mus musculus


Alignment Length:274 Identity:62/274 - (22%)
Similarity:108/274 - (39%) Gaps:58/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 ARLSYAASLRIRRQKTHHKTAKTALLFCL--LWFAANYFFQLALEMDEAAMITLVSSTSSFFIIC 218
            ::.|..|..|:...:..:|..:|..|...  ::...|....:||...:||...:   |....|:.
Mouse    74 SKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQV---TYQLKILT 135

  Fly   219 LAAVFPSATGDKLTITKVIAVAMNIGGVVAI----TMNDLHDTKMTRG--------VLLALFSAF 271
            .|....|..|.||.:.:.:::.:.:.||..:    ...:|:...::.|        ||.|.||:.
Mouse   136 TALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSG 200

  Fly   272 FYAAYLVFVKRKSDTEEKV---DIPL-FFGFVGLWNMLLLWPIFFILHFTKIETFELPSQGQF-- 330
            |...|  |.|...:|::.|   :|.| |||.:            |.|....:...||.|:..|  
Mouse   201 FAGVY--FEKILKETKQSVWIRNIQLGFFGSI------------FGLMGVYVYDGELVSKNGFFQ 251

  Fly   331 ----------ALLFLNGLV-GTVLSEALWLWGCFLTSSLIGTLAMSLQIPLAILFDVL-LKNKPY 383
                      ||..|.||| ..|:..|         .:::...|.||.|.|:.:.... |::...
Mouse   252 GYNQLTWIVVALQALGGLVIAAVIKYA---------DNILKGFATSLSIILSTIISYFWLQDFVP 307

  Fly   384 SPMFYMGSIPIFVA 397
            :.:|::|:|.:..|
Mouse   308 TSVFFLGAILVIAA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 62/274 (23%)
EamA 260..403 CDD:279264 41/164 (25%)
Slc35a3XP_006501488.1 Nuc_sug_transp 13..326 CDD:282054 62/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.