DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and Slc35f1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_848790.2 Gene:Slc35f1 / 215085 MGIID:2139810 Length:408 Species:Mus musculus


Alignment Length:339 Identity:66/339 - (19%)
Similarity:118/339 - (34%) Gaps:99/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PTYVPIRSPHLGAGGQSNGTSNSISGTESDDSSVRSVRFSKM------AEVREM--------SAH 148
            |.:|.....:|.|.| |.|.|.|.|...|....:|.|...:|      .:|..:        |.:
Mouse    20 PNHVVTTIENLPAEG-SGGVSLSASSRASMRQRIRKVLNREMLISVALGQVLSLLVCGIGLTSKY 83

  Fly   149 EATD-------------ALMARLSYAASLRIRRQKTH-----HKTAKTALLFCLLWFAANYFFQL 195
            .|.|             .::..|.|..:|.:|:.:.:     .:.....::..|:...|||....
Mouse    84 LAEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGLIDLEANYLVVK 148

  Fly   196 A--------LEMDEAAMITLVSSTSSFF-------------IICLAAVFPSATGDKLT------- 232
            |        :::.:..:|.:|...|.||             ::|:..:......|.|.       
Mouse   149 AYQYTTLTSVQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAG 213

  Fly   233 ITKVIAVAMNIGGVVAITMNDLHDTKMTRGV-------LLALFSAFFYAAYLVFVKRKSDTEEKV 290
            ..|::...:.:||.....::::.:..:.|.:       ::.||.|||....|..::.|    |.:
Mouse   214 ENKLVGDLLVLGGATLYGISNVWEESIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHK----ELL 274

  Fly   291 DIP-------LFFGF----VGLW---------------NMLLLWPIFFILHFTKIETFELPSQGQ 329
            .:|       |:.||    .||:               |:.||....:.| |..:..|.....|.
Mouse   275 KVPWDWQIGLLYVGFSACMFGLYSFMPVVIKKTSATSVNLSLLTADLYSL-FCGLFLFHYKFSGL 338

  Fly   330 FALLFLNGLVGTVL 343
            :.|.|...|:|.||
Mouse   339 YLLSFFTILIGLVL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 48/257 (19%)
EamA 260..403 CDD:279264 28/117 (24%)
Slc35f1NP_848790.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 66/339 (19%)
SLC35F 56..355 CDD:283644 53/302 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.