DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and nstp-3

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_504521.2 Gene:nstp-3 / 191128 WormBaseID:WBGene00022577 Length:344 Species:Caenorhabditis elegans


Alignment Length:279 Identity:58/279 - (20%)
Similarity:101/279 - (36%) Gaps:74/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LSYAASLRIRRQKTHHKTAKTALLFCLLWFAANYFFQLALEMDEAAMITLVSSTSSFFIICLAAV 222
            :.|...|::...:...:|.|..:. .|::...|..:.:||...||         ::|.|.....:
 Worm    70 MKYINELKLAIFEHRSETLKVCIP-ALIYTLQNNLYYIALSHLEA---------TTFCISYQMKI 124

  Fly   223 FPSA------TGDKLTITKVIAVAMNIGGVVAI--------TMNDLHDTKM--TRGVLLALFSAF 271
            |.:|      .|.||:..:..|:.:.:.||..|        ...|:....|  ...||...|::.
 Worm   125 FTTAIFMYFFLGKKLSTKQWWALVLLVLGVADIQYVYSPPPASEDVEQNPMYGFMAVLTMCFTSA 189

  Fly   272 FYAAYLVFVKRKSDTEEKVD------IPLFFGFVGLWNMLLLWPIFFILHFTKIETFELPSQGQF 330
            |...||..|.:.|:....|.      |.|...|:.:|          ...:.||.     .||.|
 Worm   190 FAGVYLEKVLKSSNASIWVQNIRLALIGLPISFLSMW----------YYDWEKIN-----EQGAF 239

  Fly   331 --------ALLFLNGLVGTVLSEALWLWGCFLTSSLIGTLAMSLQIPLA-----ILFDVLLKNKP 382
                    .|...|.:.|.::|..:     ....:::...|.|:.|..|     ||||       
 Worm   240 RGWDFVVVCLTVTNSVGGILISVVI-----KYADNILKAYAQSMAIIGAAVGSWILFD------- 292

  Fly   383 YSP--MFYMGSIPIFVALV 399
            ::|  ||.:|:..:.|:::
 Worm   293 FAPGFMFLLGTFMVIVSII 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 58/277 (21%)
EamA 260..403 CDD:279264 35/161 (22%)
nstp-3NP_504521.2 Nuc_sug_transp 6..314 CDD:282054 58/279 (21%)
EamA 89..313 CDD:304911 55/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.